Cagrilintide vs Retatrutide: prices, identity and regulatory status (2026)
Cagrilintide and Retatrutide are different research compounds, not substitutes for each other: Cagrilintide is a 38-amino-acid peptide (C194H312N54O59S2); Retatrutide is a single compound (C221H342N46O68). Neither product has a current in-stock price right now. Cagrilintide has no Drugs@FDA application; Retatrutide has no Drugs@FDA application.
Cagrilintide vs Retatrutide: current prices and packages
| Compared property | Cagrilintide | Retatrutide |
|---|---|---|
| Category | GLP-1 | GLP-1 |
| Compared package | 10mg | 30mg |
| Lowest current price | No current in-stock price | No current in-stock price |
| Price per labelled mg | — | — |
| Package sizes | 5mg, 10mg, 20mg | 5mg, 10mg, 15mg, 20mg, 30mg, 40mg, 48mg, 50mg, 60mg |
| Vendors with current prices | 0 | 0 |
| Form at this package | No listing | No listing |
| Stock | Out of stock | Out of stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Cagrilintide | Retatrutide |
|---|---|---|
| Molecular formula | C194H312N54O59S2 | C221H342N46O68 |
| Molecular weight | 4409 g/mol | 4731 g/mol |
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (38 residues) | — |
| CAS Registry Number | — | — |
| Registered clinical trials | 40 (16 active) · Phase 3: 19, Phase 2: 4, Phase 1: 17 | 34 (11 active) · Phase 3: 14, Phase 2: 4, Phase 1: 15 |
| Human intervention studies | 4 | 7 |
| US regulatory status | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Cagrilintide
- Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. The New England journal of medicine, 2025
- Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. The New England journal of medicine, 2025
- Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet (London, England), 2023
Retatrutide
- Efficacy and safety of retatrutide, a GIP, GLP-1, and glucagon receptor agonist, in people with type 2 diabetes and inadequate glycaemic control with diet and exercise (TRANSCEND-T2D-1): a double-blind, randomised, phase 3 trial. Lancet (London, England), 2026
- Effects of retatrutide on body composition in people with type 2 diabetes: a substudy of a phase 2, double-blind, parallel-group, placebo-controlled, randomised trial. The lancet. Diabetes & endocrinology, 2025
- Triple hormone receptor agonist retatrutide for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trial. Nature medicine, 2024
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
Cagrilintide
Cagrilintide is a catalogue entry whose compound-specific reference review has not yet been completed.
No vendor has a current in-stock price for this package.
Cagrilintide prices →Price history →Retatrutide
Retatrutide, also identified as LY3437943, is an investigational agonist at GIP, GLP-1 and glucagon receptors. A peer-reviewed phase 2 trial and a later sponsor-described phase 3 program are different levels of source evidence.
No vendor has a current in-stock price for this package.
Retatrutide prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price, except that the labelled featured partner, LA Peptides, is pinned first; “Cheapest” always marks the lowest price. PeptideTech earns a commission when you buy through a link.
Full method →