Home / Research library / Cagrilintide
Cagrilintide: molecular data, studies & sources
Cagrilintide is catalogued here as a research compound. This profile brings together the molecular source record, selected indexed publications and available supplier comparisons. Evidence for a named substance does not authenticate a commercial product.
Compiled by PeptideTech Editors · Sources checked · Selected bibliography, not a systematic review
Molecular formula, weight & structure
- Molecular formula (MF)
- C194H312N54O59S2
- Molecular weight (MW)
- 4409 g/mol
- PubChem compound ID
- 171397054
- Record title
- Cagrilintide
Values describe the selected PubChem molecular entity. Counterions, salt forms, hydration and sequence changes can alter the supplied material. Confirm the exact identity against the supplier specification.
Source: PubChem CID 171397054 · retrieved 2026-09-21
Chemical identifiers and source data
- IUPAC name
- 20-[[(1S)-4-[[(2S)-6-amino-1-[[(4R,7S,10S,13S,16S,19R)-4-[[(2S)-1-[[(2S,3R)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2R)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-4-amino-1-[[(2S)-1-[[2-[(2S)-2-[[(2S,3S)-1-[[(2R)-1-[(2R)-2-[(2R)-2-[[(2R,3S)-1-[[(2R)-4-amino-1-[[(2R)-1-[[2-[[(2R)-1-[[(2R)-4-amino-1-[[(2R,3S)-1-[(2R)-2-carbamoylpyrrolidin-1-yl]-3-hydroxy-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-4-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxopropan-2-yl]carbamoyl]-16-(2-amino-2-oxoethyl)-7,13-bis[(1R)-1-hydroxyethyl]-10-methyl-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentazacycloicos-19-yl]amino]-1-oxohexan-2-yl]amino]-1-carboxy-4-oxobutyl]amino]-20-oxoicosanoic acid
- InChIKey
- LDERDVMBIYGIOI-IZVMHKDJSA-N
- SMILES
- CC[C@H](C)[C@@H](C(=O)N[C@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)N2CCC[C@@H]2C(=O)N[C@H]([C@H](C)O)C(=O)N[C@H](CC(=O)N)C(=O)N[C@H](C(C)C)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](CC(=O)N)C(=O)N[C@H]([C@H](C)O)C(=O)N3CCC[C@@H]3C(=O)N)NC(=O)[C@@H]4CCCN4C(=O)CNC(=O)[C@H](CC5=CC=CC=C5)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC6=CNC=N6)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC7=CC=CC=C7)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)NC(=O)[C@@H]8CSSC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N8)[C@@H](C)O)C)[C@@H](C)O)CC(=O)N)NC(=O)[C@H](CCCCN)NC(=O)CC[C@@H](C(=O)O)NC(=O)CCCCCCCCCCCCCCCCCCC(=O)O
Identifiers & sequence
- PubChem CID
- 171397054
- ChEMBL ID
- CHEMBL4802169
- InChIKey
- LDERDVMBIYGIOI-IZVMHKDJSA-N
Other names and development codes: NNC0174-0833
Peptide sequence · 38 residues (one-letter code; X marks a residue without a one-letter code)
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Source: PubChem Biologic Line Notation. A reference sequence for the record, not an analysis of a supplied batch.
Calculated molecular descriptors
| Monoisotopic (exact) mass | 4406.2515 Da |
|---|---|
| Heavy atoms | 309 |
| Hydrogen-bond donors | 60 |
| Hydrogen-bond acceptors | 62 |
| Rotatable bonds | 135 |
| Topological polar surface area | 1824.5 Ų |
| Calculated logP (Crippen) | -19.06 |
| Rings | 8 |
| Stereocenters | 42 |
| Formal charge | 0 |
Computed with RDKit from the published SMILES (Crippen logP, topological polar surface area). Calculated descriptors are not measured properties of a supplied batch.
US regulatory status & drug development
Drugs@FDA lists no NDA, BLA or ANDA with cagrilintide as an active ingredient (names searched: CAGRILINTIDE; checked October 7, 2026). Research-labelled Cagrilintide listings are not FDA-approved drugs.
An FDA approval covers a defined medicine, formulation and labelled use. It does not extend to research-labelled material sold under the same compound name. Identity basis: Investigational INN.
Source: Drugs@FDA via openFDA (active-ingredient search for CAGRILINTIDE) · checked . openFDA data are not intended for clinical decisions.
Drug development record (ChEMBL)
Harmonized drug-development record from ChEMBL. The highest clinical stage is the furthest stage reached, as recorded by ChEMBL; it can lag regulatory approvals, and it is not an approval of a research-supplier product.
- ChEMBL ID
- CHEMBL4802169
- Modality
- Protein / peptide
- Highest clinical stage
- Phase 3
- Record name
- CAGRILINTIDE
Synonyms, codes and trade names
- Synonyms and development codes
- Cagrilintide · NNC0174-0833
Identity check: PubChem / GSRS ChEMBL cross-reference and an exact name match. Source: ChEMBL CHEMBL4802169 (EMBL-EBI, CC BY-SA 3.0) · retrieved 2026-10-07
Registered clinical trials
Studies registered on ClinicalTrials.gov that list Cagrilintide as an intervention. Studies that only measure the molecule as a biomarker, or use it only as a comparator or background arm for another drug, are excluded. A registration describes a planned or completed protocol; it does not report a result. Active studies are listed first.
40 registered studies matched, 16 currently active or recruiting, 1 with results posted on ClinicalTrials.gov.
- By highest phase
- Phase 3 · 19Phase 2 · 4Phase 1 · 17
- By registry status
- Completed · 24Recruiting · 9Active Not Recruiting · 7
| Study | Phase · status | Conditions | Sponsor · size |
|---|---|---|---|
| A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in Children and Adolescents With Type 2 DiabetesNCT07282613 · start 2026-08-04 · primary completion 2029-09-07 | Phase 3Recruiting | Diabetes Mellitus, Type 2 | Novo Nordisk A/S80 participants |
| A Research Study to Compare Two Different Versions of Injectable Cagrilintide and Placebo in People With Excess Body WeightNCT07745504 · start 2026-08-04 · primary completion 2027-05-18 | Phase 3Recruiting | Overweight · Obesity | Novo Nordisk A/S285 participants |
| A Research Study to Compare Blood Levels of Cagrilintide After Multiple Doses of Different Versions of Cagrilintide in Adults With Overweight or ObesityNCT07597018 · start 2026-05-18 · primary completion 2027-05-28 | Phase 1Recruiting | Obesity · Overweight | Novo Nordisk A/S234 participants |
| Evaluation of the Tolerability of Cagrilintide in Participants Not Tolerating GLP-1-RA Therapies Due to Gastrointestinal Adverse EventsNCT07607587 · start 2026-05-29 · primary completion 2027-11-19 | Phase 1Recruiting | Obesity · Overweight | Novo Nordisk A/S114 participants |
| Understanding the Effect of CagriSema, Cagrilintide, and Semaglutide on Muscle Health (Role of Amylin Signature in Muscle Health)NCT07527195 · start 2026-04-10 · primary completion 2028-04-28 | Phase 1Recruiting | Obesity | Novo Nordisk A/S100 participants |
| A Research Study Looking Into How Cagrilintide Influences Food Intake and Appetite in People With Overweight or ObesityNCT07557953 · start 2026-04-30 · primary completion 2027-04-13 | Phase 1Recruiting | Overweight · Obesity | Novo Nordisk A/S120 participants |
| A Study Looking at How Weekly Injections of Two Hormones - GIP and Amylin - Affect Stomach-related Side Effects in People Who Are Overweight or ObeseNCT07411560 · start 2026-02-09 · primary completion 2027-01-26 | Phase 1Recruiting | Overweight · Obese | Novo Nordisk A/S100 participants |
| A Research Study on How Well Cagrilintide and CagriSema Work in Children and Adolescents With Excess Body WeightNCT07253285 · start 2026-01-08 · primary completion 2030-03-20 | Phase 3Recruiting | Overweight · Obesity | Novo Nordisk A/S460 participants |
| Weight Loss in People Living With Overweight or Obesity Following Treatment With CagrilintideNCT07220642 · start 2025-11-05 · primary completion 2027-05-11 | Phase 3Active Not Recruiting | Obesity · Overweight | Novo Nordisk A/S300 participants |
| Weight Loss in People Living With Overweight or Obesity and Type 2 Diabetes Following Treatment With CagrilintideNCT07220759 · start 2025-11-05 · primary completion 2027-05-12 | Phase 3Active Not Recruiting | Overweight · Obesity · Type 2 Diabetes | Novo Nordisk A/S330 participants |
Show 30 more registered studies
Registry check 2026-10-09 · Run this search on ClinicalTrials.gov
Human intervention studies
Selected studies in which participants received Cagrilintide, with their indexed or reviewed study type. Check the original article for the formulation, population and controls. Studies that only measured the molecule, or used it as a comparator, are listed separately below and are not counted as intervention studies.
- Human study · PubMed trial index Compound given to participants
Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity.
Garvey WT, Blüher M, Osorto Contreras CK et al. · The New England journal of medicine · 2025
PMID 40544433 · DOI: 10.1056/NEJMoa2502081 · Registration NCT05567796
- Human study · PubMed trial index Compound given to participants
Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes.
Davies MJ, Bajaj HS, Broholm C et al. · The New England journal of medicine · 2025
PMID 40544432 · DOI: 10.1056/NEJMoa2502082 · Registration NCT05394519
- Human study · PubMed trial index Compound given to participants
Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial.
Lau DCW, Erichsen L, Francisco AM et al. · Lancet (London, England) · 2021
PMID 34798060 · DOI: 10.1016/S0140-6736(21)01751-7
- Human study · PubMed trial index Compound given to participants
Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial.
Frias JP, Deenadayalan S, Erichsen L et al. · Lancet (London, England) · 2023
PMID 37364590 · DOI: 10.1016/S0140-6736(23)01163-7 · Registration NCT04982575
Preclinical research, reviews & other publications
Animal studies, laboratory experiments, reviews and other indexed papers answer different questions. A review is secondary evidence; a case report does not estimate how often an outcome occurs.
- Research publication · design requires review
Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity.
D'Ascanio AM, Mullally JA, Frishman WH et al. · Cardiology in review · 2024 Jan-Feb 01
PMID 36883831 · DOI: 10.1097/CRD.0000000000000513
Cagrilintide supplier sources
Scientific sources describe molecules and experiments. The commercial links below identify recorded supplier packages. A publication or chemical database entry does not verify the seller, purity, sterility or contents of a lot. Some links are affiliate links; see our disclosure.
Cagrilintide for sale: compare prices, sizes and forms from every tracked supplier →
| Supplier | Recorded packages | Example source listing |
|---|---|---|
| American PeptidesUSD | 10mg Vial1 recorded offers | 10mg Vial · $170.00Checked Nov 6, 2026Supplier listing, Cagrilintide 10mg Vial, American Peptides, opens in a new tab |
| Amino ClubUSD | 10mg Vial1 recorded offers | 10mg Vial · $69.99Stale observation · Checked Oct 14, 2026Supplier listing, Cagrilintide 10mg Vial, Amino Club, opens in a new tab |
| Amino USAUSD | 10mg Vial · 5mg Vial2 recorded offers | 10mg Vial · $102.00Checked Nov 6, 2026Supplier listing, Cagrilintide 10mg Vial, Amino USA, opens in a new tab |
| Cenexa LabsUSD | 10mg Vial1 recorded offers | 10mg Vial · $159.99Stale observation · Checked Oct 7, 2026Supplier listing, Cagrilintide 10mg Vial, Cenexa Labs, opens in a new tab |
| LA PeptidesUSD | 10mg Vial1 recorded offers | 10mg Vial · $99.99Checked Nov 3, 2026Supplier listing, Cagrilintide 10mg Vial, LA Peptides, opens in a new tab |
Reference sources & further reading
- PubChem compound record 171397054 — chemical identity and structure.
- ChEMBL drug record CHEMBL4802169 — development stage, mechanism and synonyms.
- Wikipedia: Cagrilintide — Background encyclopedia; not a primary clinical source.
The citations above link directly to publication records. Encyclopedia links are background reading and are not used to establish clinical effectiveness.
Search for additional research
These links run searches; their results have not been individually reviewed and can include unrelated compounds.
Research information is not a dosing guide or a recommendation for personal use. Study findings are specific to the formulation, population and methods tested. Read our source and correction policy.
Related research profiles
Eloralintide
Molecular identity needs further verification
4 selected publications · 3 human intervention studies · 22 registered trials
Liraglutide
C172H265N43O51
3751 g/mol · PubChem CID 16134956
7 selected publications · 4 human intervention studies · 33 registered trials
US: active ingredient of an FDA-approved medicine · Drugs@FDA
Protein / peptide · highest stage: Approved in at least one jurisdiction (ChEMBL phase 4)
Mazdutide
C207H317N45O65
4476 g/mol · PubChem CID 167312357
7 selected publications · 6 human intervention studies · 40 registered trials
Protein / peptide · highest stage: Phase 3
Orforglipron Capsules
C48H48F2N10O5
883.0 g/mol · PubChem CID 137319706
8 selected publications · 6 human intervention studies · 40 registered trials
Small molecule · highest stage: Phase 3
Retatrutide
C221H342N46O68
4731 g/mol · PubChem CID 171390338
9 selected publications · 7 human intervention studies · 34 registered trials
Semaglutide
C187H291N45O59
4114 g/mol · PubChem CID 56843331
8 selected publications · 5 human intervention studies · 34 registered trials
US: active ingredient of an FDA-approved medicine · Drugs@FDA
Protein / peptide · highest stage: Approved in at least one jurisdiction (ChEMBL phase 4)