Sermorelin vs Tesamorelin: price per mg, identity and regulatory status (2026)
Sermorelin and Tesamorelin are different research compounds, not substitutes for each other: Sermorelin is a 29-amino-acid peptide (C149H246N44O42S); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Lowest current in-stock prices: Sermorelin 5mg from $49.99 ($10.00/mg) at Nova Peptide Supply; Tesamorelin 10mg from $74.99 ($7.50/mg) at LA Peptides. Sermorelin was FDA-approved but every application is discontinued; Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
Research use only. These are research-use-only listings sold for laboratory research, not prescription medicines and not for human use. PeptideTech does not compare effects or provide dosing information.
Sermorelin vs Tesamorelin: current prices and packages
| Compared property | Sermorelin | Tesamorelin |
|---|---|---|
| Category | Growth hormone | Growth hormone |
| Compared package | 5mg · Vial | 10mg · Vial |
| Lowest current price | $49.99 at Nova Peptide Supply, checked Oct 31, 2026 | $74.99 at LA Peptides, checked Oct 31, 2026 |
| Price per labelled mg | $10.00/mg | $7.50/mg |
| Package sizes | 2mg, 5mg, 10mg, 15mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 3 | 4 (7 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Sermorelin | Tesamorelin |
|---|---|---|
| Molecular formula | C149H246N44O42S | C221H366N72O67S |
| Molecular weight | 3357.9 g/mol | 5136 g/mol |
| Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (29 residues) | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 86168-78-7 | 218949-48-5 |
| Registered clinical trials | None recorded | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | 2 | 7 |
| US regulatory status | FDA-approved as Geref, all applications discontinued (NDA 019863 and NDA 020443; checked October 7, 2026)DiscontinuedGEREF · NDA 019863 · 1990GEREF · NDA 020443 · 1997Research listings are not these medicines. | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Sermorelin
- Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy. Geref International Study Group. The Journal of clinical endocrinology and metabolism, 1996
- A comparative study of growth hormone (GH) and GH-releasing hormone(1-29)-NH2 for stimulation of growth in children with GH deficiency. Acta paediatrica (Oslo, Norway : 1992). Supplement, 1993
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Research-use listings for each compound
Research-use-only listings sold for laboratory research, not prescription medicines and not for human use.
Sermorelin
Sermorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$49.99 · 5mg · $10.00/mg · Nova Peptide Supply
View at Nova Peptide Supply, Sermorelin 5mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankSermorelin prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$74.99 · 10mg · $7.50/mg · LA Peptides
View at LA Peptides, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price, except that the labelled featured partner, LA Peptides, is pinned first; “Cheapest” always marks the lowest price. PeptideTech earns a commission when you buy through a link.
Full method →