Sermorelin vs Tesamorelin: price per mg, identity and regulatory status (2026)
Sermorelin and Tesamorelin are different research compounds, not substitutes for each other: Sermorelin is a 29-amino-acid peptide (C149H246N44O42S); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Lowest current in-stock prices: Sermorelin 5mg from $49.99 ($10.00/mg) at Nova Peptide Supply; Tesamorelin 10mg from $69.99 ($7.00/mg) at Amino Club. Sermorelin was FDA-approved but every application is discontinued; Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
Research use only. These are research-use-only listings sold for laboratory research, not prescription medicines and not for human use. PeptideTech does not compare effects or provide dosing information.
Sermorelin vs Tesamorelin: current prices and packages
| Compared property | Sermorelin | Tesamorelin |
|---|---|---|
| Category | Growth hormone | Growth hormone |
| Compared package | 5mg · Vial | 10mg · Vial |
| Lowest current price | $49.99 at Nova Peptide Supply, checked Oct 16, 2026 | $69.99 at Amino Club, checked Oct 14, 2026 |
| Price per labelled mg | $10.00/mg | $7.00/mg |
| Package sizes | 2mg, 5mg, 10mg, 15mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 3 | 5 (6 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Sermorelin | Tesamorelin |
|---|---|---|
| Molecular formula | C149H246N44O42S | C221H366N72O67S |
| Molecular weight | 3357.9 g/mol | 5136 g/mol |
| Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (29 residues) | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 86168-78-7 | 218949-48-5 |
| Registered clinical trials | None recorded | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | 2 | 7 |
| US regulatory status | FDA-approved as Geref, all applications discontinued (NDA 019863 and NDA 020443; checked October 7, 2026)DiscontinuedGEREF · NDA 019863 · 1990GEREF · NDA 020443 · 1997Research listings are not these medicines. | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Sermorelin
- Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy. Geref International Study Group. The Journal of clinical endocrinology and metabolism, 1996
- A comparative study of growth hormone (GH) and GH-releasing hormone(1-29)-NH2 for stimulation of growth in children with GH deficiency. Acta paediatrica (Oslo, Norway : 1992). Supplement, 1993
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Research-use listings for each compound
Research-use-only listings sold for laboratory research, not prescription medicines and not for human use.
Sermorelin
Sermorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$49.99 · 5mg · $10.00/mg · Nova Peptide Supply
View at Nova Peptide Supply, Sermorelin 5mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankSermorelin prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$69.99 · 10mg · $7.00/mg · Amino Club
View at Amino Club, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →