Skip to content
PeptideTech
sign in
live116 compounds · 15 vendors listed · 7 graded · audit of 4 Nov 2026 · prices checked 6 Nov 2026independent · grades can’t be bought

Home / Research library / Tesamorelin

Peptides

Tesamorelin: molecular data, studies & sources

Tesamorelin is catalogued here as a research compound. This profile brings together the molecular source record, selected indexed publications and available supplier comparisons. Evidence for a named substance does not authenticate a commercial product.

Compiled by PeptideTech Editors · Sources checked · Selected bibliography, not a systematic review

Molecular formula, weight & structure

Molecular formula (MF)
C221H366N72O67S
Molecular weight (MW)
5136 g/mol
PubChem compound ID
16137828
Record title
Tesamorelin

Values describe the selected PubChem molecular entity. Counterions, salt forms, hydration and sequence changes can alter the supplied material. Confirm the exact identity against the supplier specification.

Source: PubChem CID 16137828 · retrieved 2026-09-21

2D molecular structure for Tesamorelin, PubChem CID 16137828
2D depiction from PubChem. Open to inspect the full image. This drawing represents the selected record, not a vendor batch test.
Chemical identifiers and source data
IUPAC name
(4S)-4-[[2-[[(2S)-5-amino-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-3-carboxy-2-[[(2S)-2-[[(2S)-2-[[(E)-hex-3-enoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]acetyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-3-carboxypropanoyl]amino]-3-methylpentanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-5-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
InChIKey
QBEPNUQJQWDYKU-BMGKTWPMSA-N
SMILES
CC/C=C/CC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N
Machine-readable PubChem source

Identifiers & sequence

PubChem CID
16137828
CAS Registry Number
218949-48-5via EPA DSSTox, FDA GSRS
FDA UNII
MQG94M5EEO
ChEMBL ID
CHEMBL1237026
InChIKey
QBEPNUQJQWDYKU-BMGKTWPMSA-N
Wikidata
Q7705415

Other names and development codes: TH-9507

Peptide sequence · 44 residues (one-letter code; X marks a residue without a one-letter code)

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Source: PubChem Biologic Line Notation. A reference sequence for the record, not an analysis of a supplied batch.

CAS numbers are published only from ChemIDplus, EPA DSSTox or the FDA Global Substance Registration System; UNII codes are confirmed in FDA GSRS by structure, sequence or exact name. Checked 2026-10-07.

Calculated molecular descriptors
Monoisotopic (exact) mass5132.7166 Da
Heavy atoms361
Hydrogen-bond donors83
Hydrogen-bond acceptors72
Rotatable bonds181
Topological polar surface area2339.4 Ų
Calculated logP (Crippen)-27.03
Rings3
Stereocenters44
Formal charge0

Computed with RDKit from the published SMILES (Crippen logP, topological polar surface area). Calculated descriptors are not measured properties of a supplied batch.

US regulatory status & drug development

Tesamorelin (listed as tesamorelin acetate) is the active ingredient of EGRIFTA, approved by the FDA under BLA 022505 (THERATECHNOLOGIES) on November 10, 2010; Drugs@FDA lists it as a marketed prescription product (checked October 7, 2026). Research-labelled Tesamorelin listings are not EGRIFTA and are not FDA-approved drugs.

FDA-approved medicines with the same active ingredient (Drugs@FDA)
MedicineApplicationSponsorFirst approvalMarketing status
EGRIFTAtesamorelin acetateBLA 022505DailyMed label: EGRIFTA WR · 2026-07-29DailyMed label: EGRIFTA SV · 2026-07-29THERATECHNOLOGIESPrescription

An FDA approval covers a defined medicine, formulation and labelled use. It does not extend to research-labelled material sold under the same compound name. Identity basis: Same active moiety: the approved product lists tesamorelin acetate; the research record is tesamorelin (PubChem CID 16137828).

Source: Drugs@FDA via openFDA (application records; DailyMed label set IDs) · checked . openFDA data are not intended for clinical decisions.

Drug development record (ChEMBL)

Harmonized drug-development record from ChEMBL. The highest clinical stage is the furthest stage reached, as recorded by ChEMBL; it can lag regulatory approvals, and it is not an approval of a research-supplier product.

ChEMBL ID
CHEMBL1237026
Modality
Protein / peptide
Highest clinical stage
Approved in at least one jurisdiction (ChEMBL phase 4)
Record name
TESAMORELIN
Synonyms, codes and trade names
Trade and brand names (Drugs@FDA)
EGRIFTA · EGRIFTA SV · EGRIFTA WR
Synonyms and development codes
Tesamorelin · TH-9507 · TH9507

Identity check: PubChem / GSRS ChEMBL cross-reference and an exact name match. Source: ChEMBL CHEMBL1237026 (EMBL-EBI, CC BY-SA 3.0) · retrieved 2026-10-07

Registered clinical trials

Studies registered on ClinicalTrials.gov that list Tesamorelin as an intervention. Studies that only measure the molecule as a biomarker, or use it only as a comparator or background arm for another drug, are excluded. A registration describes a planned or completed protocol; it does not report a result. Active studies are listed first.

20 registered studies matched, 3 currently active or recruiting, 8 with results posted on ClinicalTrials.gov.

By highest phase
Phase 4 · 2Phase 3 · 2Phase 2 · 9Phase 1 · 1Not applicable · 6
By registry status
Completed · 10Terminated · 4Recruiting · 3Withdrawn · 3
StudyPhase · statusConditionsSponsor · size
Tesamorelin for Reduction of Liver Fat in Adults With Fatty Liver Disease (Mock Study)NCT07481734 · start 2026-02-02 · primary completion 2027-02-14Phase 2RecruitingMetabolic Associated Steatotic Liver Disease · Nonalcoholic Steatohepatitis · Hepatic SteatosisHudson Biotech120 participants
Tesamorelin as an Adjunct to Exercise for Improving Physical Function in HIVNCT06554717 · start 2025-07-10 · primary completion 2028-06-16Phase 2RecruitingHIV-1-infection · Frailty · Impaired Physical Function · Abdominal Obesity · AgingMassachusetts General Hospital100 participants
Tesamorelin to Improve Functional Outcomes After Peripheral Nerve InjuryNCT03150511 · start 2018-06-01 · primary completion 2027-12Phase 2RecruitingPeripheral Nerve InjuriesJohns Hopkins University36 participants
Growth Hormone Releasing Hormone Analog to Improve Nonalcoholic Fatty Liver Disease and Associated Cardiovascular RiskNCT03375788 · start 2019-01-17 · primary completion 2024-07-10Phase 2CompletedResults posted 2025-11-20Non-Alcoholic Fatty Liver Disease · Obesity · Obesity, Abdominal · Liver Fat · Fatty LiverMassachusetts General Hospital51 participants
Body Composition and Adipose Tissue in HIVNCT03226821 · start 2018-02-07 · primary completion 2025-04-30Phase 4TerminatedResults posted 2026-05-19Why stopped: lack of availability of the study drugHIV Lipodystrophy Syndrome · Growth Hormone Deficiency · Body CompositionColumbia University6 participants
Phase II Trial of Tesamorelin for Cognition in Aging HIV-Infected PersonsNCT02572323 · start 2017-02-15 · primary completion 2023-10-15Phase 2CompletedResults posted 2026-03-12Mild Cognitive ImpairmentUniversity of California, San Diego73 participants
Impact of GHRH on Sleep Promotion and Endocrine Regulation in Service Members Who Sustained a Traumatic Brain Injury and Have Current InsomniaNCT02931474 · start 2016-10-06 · primary completion 2017-03-08Phase 2WithdrawnSleep Disorder · Traumatic Brain InjuryNational Institute of Nursing Research (NINR)Enrollment not listed
Tesamorelin Effects on Liver Fat and Histology in HIVNCT02196831 · start 2015-07-01 · primary completion 2019-01-16Not applicableCompletedResults posted 2020-01-13Human Immunodeficiency Virus (HIV) · Nonalcoholic Fatty Liver Disease (NAFLD) · Nonalcoholic Steatohepatitis (NASH)Massachusetts General Hospital61 participants
Abdominal Obesity, Cardiovascular Inflammation, and Effects of Growth Hormone Releasing Hormone AnalogueNCT01632592 · start 2014-01 · primary completion 2014-01Not applicableWithdrawnWhy stopped: No funding availableAbdominal ObesityMassachusetts General HospitalEnrollment not listed
Long-term Observational Study in HIV Subjects Exposed to EGRIFTA®NCT01579695 · start 2013-02 · primary completion 2018-05Not applicableTerminatedHIVTheratechnologies391 participants
Show 10 more registered studies
StudyPhase · statusConditionsSponsor · size
Diabetic Retinopathy in HIV Subjects Treated With EGRIFTA®NCT01591902 · start 2012-06 · primary completion 2018-05Phase 4TerminatedDiabetic Retinopathy · HIVTheratechnologies129 participants
Egrifta Replacement and Sleep Disordered BreathingNCT01788462 · start 2012-05 · primary completion 2020-01Not applicableWithdrawnWhy stopped: Lack of funding.LipodystrophyJohns Hopkins UniversityEnrollment not listed
Efficacy and Safety Study of Tesamorelin in Chronic Obstructive Pulmonary Disease (COPD) Subjects With Muscle WastingNCT01388920 · start 2011-09 · primary completion 2011-12Phase 2TerminatedResults posted 2014-05-07Why stopped: The study was terminated based on a non-safety related corporate decision.Chronic Obstructive Pulmonary Disease (COPD)Theratechnologies3 participants
Effects of Growth Hormone Releasing Hormone in HIVNCT01263717 · start 2010-12 · primary completion 2014-02Not applicableCompletedResults posted 2014-10-13HIV · HIV LipodystrophyMassachusetts General Hospital54 participants
Effect of Short Term Growth Hormone Releasing Hormone in Healthy MenNCT00850564 · start 2009-02 · primary completion 2010-04Not applicableCompletedResults posted 2011-03-30Healthy VolunteersMassachusetts General Hospital15 participants
Pharmacokinetic and Pharmacodynamic Study of TH9507, a Growth Hormone-Releasing Factor Analog, in HIV Positive PatientsNCT02012556 · start 2008-05 · primary completion 2008-07Phase 1CompletedHIVTheratechnologies18 participants
TH9507 Extension Study in Patients With HIV-Associated LipodystrophyNCT00608023 · start 2007-08 · primary completion 2008-10Phase 3CompletedResults posted 2014-01-15Lipodystrophy · HIV InfectionsTheratechnologies263 participants
SMART: Somatotrophics, Memory, and Aging Research TrialNCT00257712 · start 2006-02 · primary completion 2011-12Phase 2CompletedAging · Mild Cognitive ImpairmentUniversity of Washington151 participants
TH9507 in Patients With HIV-Associated LipodystrophyNCT00123253 · start 2005-06 · primary completion 2006-11Phase 3CompletedHIV Infections · LipodystrophyTheratechnologies412 participants
Safety Study of TH9507 in Subjects With Stable, Type 2 DiabetesNCT01264497 · start 2002-02 · primary completion 2002-11Phase 2CompletedType 2 DiabetesTheratechnologies55 participants

Registry check 2026-10-09 · Run this search on ClinicalTrials.gov

Human intervention studies

Selected studies in which participants received Tesamorelin, with their indexed or reviewed study type. Check the original article for the formulation, population and controls. Studies that only measured the molecule, or used it as a comparator, are listed separately below and are not counted as intervention studies.

  1. Human study · PubMed trial index Compound given to participants

    Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors.

    Russo SC, Ockene MW, Arpante AK et al. · AIDS (London, England) · 2024

    PMID 38905488 · DOI: 10.1097/QAD.0000000000003965

  2. Human study · PubMed trial index Compound given to participants

    Safety and metabolic effects of tesamorelin, a growth hormone-releasing factor analogue, in patients with type 2 diabetes: A randomized, placebo-controlled trial.

    Clemmons DR, Miller S, Mamputu JC et al. · PloS one · 2017

    PMID 28617838 · DOI: 10.1371/journal.pone.0179538 · Registration NCT01264497

  3. Human study · PubMed trial index Compound given to participants

    Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity.

    Ellis RJ, Vaida F, Hu K et al. · The Journal of infectious diseases · 2025

    PMID 39813152 · DOI: 10.1093/infdis/jiaf012

  4. Human study · PubMed trial index Compound given to participants

    Effects of tesamorelin on inflammatory markers in HIV patients with excess abdominal fat: relationship with visceral adipose reduction.

    Stanley TL, Falutz J, Mamputu JC et al. · AIDS (London, England) · 2011

    PMID 21516030 · DOI: 10.1097/QAD.0b013e328347f3f1

  5. Human study · PubMed trial index Compound given to participants

    Metabolic effects of a growth hormone-releasing factor in patients with HIV.

    Falutz J, Allas S, Blot K et al. · The New England journal of medicine · 2007

    PMID 18057338 · DOI: 10.1056/NEJMoa072375 · Registration NCT00123253

  6. Human study · PubMed trial index Compound given to participants

    Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension.

    Falutz J, Potvin D, Mamputu JC et al. · Journal of acquired immune deficiency syndromes (1999) · 2010

    PMID 20101189 · DOI: 10.1097/QAI.0b013e3181cbdaff · Registration NCT00608023

  7. Human study · PubMed trial index Compound given to participants

    Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial.

    Stanley TL, Fourman LT, Feldpausch MN et al. · The lancet. HIV · 2019

    PMID 31611038 · DOI: 10.1016/S2352-3018(19)30338-8 · Registration NCT02196831

Preclinical research, reviews & other publications

Animal studies, laboratory experiments, reviews and other indexed papers answer different questions. A review is secondary evidence; a case report does not estimate how often an outcome occurs.

No additional matching publication was retained. The search links below allow further investigation; they are not evidence that a study exists.

    Tesamorelin supplier sources

    Scientific sources describe molecules and experiments. The commercial links below identify recorded supplier packages. A publication or chemical database entry does not verify the seller, purity, sterility or contents of a lot. Some links are affiliate links; see our disclosure.

    Tesamorelin for sale: compare prices, sizes and forms from every tracked supplier →

    SupplierRecorded packagesExample source listing
    American PeptidesUSD10mg Vial · 20mg Vial2 recorded offers10mg Vial · $120.00Stale observation · Checked Oct 21, 2026Supplier listing, Tesamorelin 10mg Vial, American Peptides, opens in a new tab
    Blank PeptidesUSD10mg Vial1 recorded offers10mg Vial · $75.00Stale observation · Checked Sep 30, 2026Supplier listing, Tesamorelin 10mg Vial, Blank Peptides, opens in a new tab
    Amino ClubUSD10mg Vial1 recorded offers10mg Vial · $69.99Stale observation · Checked Oct 14, 2026Supplier listing, Tesamorelin 10mg Vial, Amino Club, opens in a new tab
    Nova Peptide SupplyUSD5mg Vial · 10mg Vial · 20mg Vial3 recorded offers5mg Vial · $49.99Checked Nov 6, 2026Supplier listing, Tesamorelin 5mg Vial, Nova Peptide Supply, opens in a new tab
    Amino USAUSD10mg Vial · 2mg Vial · 5mg Vial3 recorded offers10mg Vial · $90.00Checked Nov 6, 2026Supplier listing, Tesamorelin 10mg Vial, Amino USA, opens in a new tab
    Cenexa LabsUSD20mg Vial · 5mg Vial · 10mg Vial3 recorded offers20mg Vial · $129.99Recorded out of stock · Checked Nov 6, 2026Supplier listing, Tesamorelin 20mg Vial, Cenexa Labs, opens in a new tab
    LA PeptidesUSD10mg Vial1 recorded offers10mg Vial · $74.99Checked Nov 3, 2026Supplier listing, Tesamorelin 10mg Vial, LA Peptides, opens in a new tab

    Reference sources & further reading

    The citations above link directly to publication records. Encyclopedia links are background reading and are not used to establish clinical effectiveness.

    Search for additional research

    These links run searches; their results have not been individually reviewed and can include unrelated compounds.

    Research information is not a dosing guide or a recommendation for personal use. Study findings are specific to the formulation, population and methods tested. Read our source and correction policy.

    Related research profiles