MK-677 vs Tesamorelin: prices, identity and regulatory status (2026)
MK-677 and Tesamorelin are different research compounds, not substitutes for each other: MK-677 is a single compound (C27H36N4O5S); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Neither product has a current in-stock price right now. MK-677 has no Drugs@FDA application; Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
MK-677 vs Tesamorelin: current prices and packages
| Compared property | MK-677 | Tesamorelin |
|---|---|---|
| Category | SARMs | Growth hormone |
| Compared package | 25mg×60 | 10mg |
| Lowest current price | No current in-stock price | No current in-stock price |
| Price per labelled mg | — | — |
| Package sizes | 25mg-per-mL-30mL, 10mg×60, 12.5mg×60, 15mg×60, 25mg×60, 2000mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 0 | 0 |
| Form at this package | No listing | No listing |
| Stock | Out of stock | Out of stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | MK-677 | Tesamorelin |
|---|---|---|
| Molecular formula | C27H36N4O5S | C221H366N72O67S |
| Molecular weight | 528.7 g/mol | 5136 g/mol |
| Sequence | — | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 159634-47-6 | 218949-48-5 |
| Registered clinical trials | 4 · Phase 2: 3, Not applicable: 1 | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | 4 | 7 |
| US regulatory status | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
MK-677
- MK-0677 (ibutamoren mesylate) for the treatment of patients recovering from hip fracture: a multicenter, randomized, placebo-controlled phase IIb study. Archives of gerontology and geriatrics, 2011
- Effects of an oral ghrelin mimetic on body composition and clinical outcomes in healthy older adults: a randomized trial. Annals of internal medicine, 2008
- Growth hormone secretagogue MK-677: no clinical effect on AD progression in a randomized trial. Neurology, 2008
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
MK-677
MK-677 is a catalogue entry whose compound-specific reference review has not yet been completed.
No vendor has a current in-stock price for this package.
MK-677 prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
No vendor has a current in-stock price for this package.
Tesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price, except that the labelled featured partner, LA Peptides, is pinned first; “Cheapest” always marks the lowest price. PeptideTech earns a commission when you buy through a link.
Full method →