Tesamorelin vs Tirzepatide: research-use prices, identity and FDA status (2026)
Tesamorelin and Tirzepatide are different research compounds, not substitutes for each other: Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S); Tirzepatide is a single compound (C225H348N48O68). Neither product has a current in-stock price right now. Tesamorelin shares its active ingredient with an FDA-approved prescription medicine; Tirzepatide shares its active ingredient with an FDA-approved prescription medicine.
Research use only. These are research-use-only listings sold for laboratory research, not prescription medicines and not for human use. PeptideTech does not compare effects or provide dosing information.
Tesamorelin vs Tirzepatide: current prices and packages
| Compared property | Tesamorelin | Tirzepatide |
|---|---|---|
| Category | Growth hormone | GLP-1 |
| Compared package | 10mg | 30mg |
| Lowest current price | No current in-stock price | No current in-stock price |
| Price per labelled mg | — | — |
| Package sizes | 2mg, 5mg, 10mg, 20mg, 50mg | 10mg, 15mg, 20mg, 30mg, 40mg, 60mg, 100mg |
| Vendors with current prices | 0 | 0 |
| Form at this package | No listing | No listing |
| Stock | Out of stock | Out of stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Tesamorelin | Tirzepatide |
|---|---|---|
| Molecular formula | C221H366N72O67S | C225H348N48O68 |
| Molecular weight | 5136 g/mol | 4813 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) | — |
| CAS Registry Number | 218949-48-5 | — |
| Registered clinical trials | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 | 38 (38 active) · Phase 4: 9, Phase 3: 6, Phase 2: 14 |
| Human intervention studies | 7 | 7 |
| US regulatory status | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. | FDA-approved prescription medicine with this active ingredient: Mounjaro and Zepbound (NDA 215866 and NDA 217806; checked October 7, 2026)MarketedMOUNJARO · NDA 215866 · 2022ZEPBOUND · NDA 217806 · 2023Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Tirzepatide
- Tirzepatide for Obesity Treatment and Diabetes Prevention. The New England journal of medicine, 2025
- Tirzepatide for Heart Failure with Preserved Ejection Fraction and Obesity. The New England journal of medicine, 2025
- Tirzepatide for the Treatment of Obstructive Sleep Apnea and Obesity. The New England journal of medicine, 2024
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Research-use listings for each compound
Research-use-only listings sold for laboratory research, not prescription medicines and not for human use.
Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
No vendor has a current in-stock price for this package.
Tesamorelin prices →Price history →Tirzepatide
Tirzepatide acts at GIP and GLP-1 receptors and is the active substance in the EU-authorized prescription medicine Mounjaro. Its medicinal-product assessment is separate from a supplier’s research catalogue listing.
No vendor has a current in-stock price for this package.
Tirzepatide prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price, except that the labelled featured partner, LA Peptides, is pinned first; “Cheapest” always marks the lowest price. PeptideTech earns a commission when you buy through a link.
Full method →