Ipamorelin vs Tesamorelin: price per mg, identity and regulatory status (2026)
Ipamorelin and Tesamorelin are different research compounds, not substitutes for each other: Ipamorelin is a 5-amino-acid peptide (C38H49N9O5); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Lowest current in-stock prices: Ipamorelin 10mg from $50.00 ($5.00/mg) at Amino USA; Tesamorelin 10mg from $79.99 ($8.00/mg) at Cenexa Labs. Ipamorelin has no Drugs@FDA application; Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
Ipamorelin vs Tesamorelin: current prices and packages
| Compared property | Ipamorelin | Tesamorelin |
|---|---|---|
| Category | Growth hormone | Growth hormone |
| Compared package | 10mg · Vial | 10mg · Vial |
| Lowest current price | $50.00 at Amino USA, checked Oct 13, 2026 | $79.99 at Cenexa Labs, checked Oct 13, 2026 |
| Price per labelled mg | $5.00/mg | $8.00/mg |
| Package sizes | 2mg, 5mg, 10mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 3 (5 tracked) | 4 (6 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Ipamorelin | Tesamorelin |
|---|---|---|
| Molecular formula | C38H49N9O5 | C221H366N72O67S |
| Molecular weight | 711.9 g/mol | 5136 g/mol |
| Sequence | H-Aib-His-D-2Nal-D-Phe-Lys-NH2 (5 residues) | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 170851-70-4 | 218949-48-5 |
| Registered clinical trials | 2 · Phase 2: 2 | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | 2 | 7 |
| US regulatory status | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Ipamorelin
- Prospective, randomized, controlled, proof-of-concept study of the Ghrelin mimetic ipamorelin for the management of postoperative ileus in bowel resection patients. International journal of colorectal disease, 2014
- Pharmacokinetic-pharmacodynamic modeling of ipamorelin, a growth hormone releasing peptide, in human volunteers. Pharmaceutical research, 1999
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
Ipamorelin
Ipamorelin is a five-amino-acid growth hormone secretagogue. Its original characterization used cell and animal experiments; a later human trial investigated a specific postoperative setting.
$50.00 · 10mg · $5.00/mg · Amino USA
View at Amino USA, Ipamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankIpamorelin prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$79.99 · 10mg · $8.00/mg · Cenexa Labs
View at Cenexa Labs, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →