Cagrilintide vs Retatrutide: price per mg, identity and regulatory status (2026)
Cagrilintide and Retatrutide are different research compounds, not substitutes for each other: Cagrilintide is a 38-amino-acid peptide (C194H312N54O59S2); Retatrutide is a single compound (C221H342N46O68). Lowest current in-stock prices: Cagrilintide 10mg from $69.99 ($7.00/mg) at Amino Club; Retatrutide 30mg from $199.99 ($6.67/mg) at Amino Club. Cagrilintide has no Drugs@FDA application; Retatrutide has no Drugs@FDA application.
Cagrilintide vs Retatrutide: current prices and packages
| Compared property | Cagrilintide | Retatrutide |
|---|---|---|
| Category | GLP-1 | GLP-1 |
| Compared package | 10mg · Vial | 30mg · Vial |
| Lowest current price | $69.99 at Amino Club, checked Oct 14, 2026 | $199.99 at Amino Club, checked Oct 14, 2026 |
| Price per labelled mg | $7.00/mg | $6.67/mg |
| Package sizes | 5mg, 10mg, 20mg | 5mg, 10mg, 15mg, 20mg, 30mg, 40mg, 48mg, 50mg, 60mg |
| Vendors with current prices | 3 (4 tracked) | 2 (3 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Cagrilintide | Retatrutide |
|---|---|---|
| Molecular formula | C194H312N54O59S2 | C221H342N46O68 |
| Molecular weight | 4409 g/mol | 4731 g/mol |
| Sequence | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP (38 residues) | — |
| CAS Registry Number | — | — |
| Registered clinical trials | 40 (16 active) · Phase 3: 19, Phase 2: 4, Phase 1: 17 | 34 (11 active) · Phase 3: 14, Phase 2: 4, Phase 1: 15 |
| Human intervention studies | 4 | 7 |
| US regulatory status | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Cagrilintide
- Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity. The New England journal of medicine, 2025
- Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes. The New England journal of medicine, 2025
- Efficacy and safety of co-administered once-weekly cagrilintide 2·4 mg with once-weekly semaglutide 2·4 mg in type 2 diabetes: a multicentre, randomised, double-blind, active-controlled, phase 2 trial. Lancet (London, England), 2023
Retatrutide
- Efficacy and safety of retatrutide, a GIP, GLP-1, and glucagon receptor agonist, in people with type 2 diabetes and inadequate glycaemic control with diet and exercise (TRANSCEND-T2D-1): a double-blind, randomised, phase 3 trial. Lancet (London, England), 2026
- Effects of retatrutide on body composition in people with type 2 diabetes: a substudy of a phase 2, double-blind, parallel-group, placebo-controlled, randomised trial. The lancet. Diabetes & endocrinology, 2025
- Triple hormone receptor agonist retatrutide for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trial. Nature medicine, 2024
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
Cagrilintide
Cagrilintide is a catalogue entry whose compound-specific reference review has not yet been completed.
$69.99 · 10mg · $7.00/mg · Amino Club
View at Amino Club, Cagrilintide 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankCagrilintide prices →Price history →Retatrutide
Retatrutide, also identified as LY3437943, is an investigational agonist at GIP, GLP-1 and glucagon receptors. A peer-reviewed phase 2 trial and a later sponsor-described phase 3 program are different levels of source evidence.
$199.99 · 30mg · $6.67/mg · Amino Club
View at Amino Club, Retatrutide 30mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankRetatrutide prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →