Skip to content
PeptideTech
Cart

Home / Research library / PNC-27

Peptides

PNC-27: molecular data, studies & sources

PNC-27 is catalogued here as a research compound. This profile brings together the molecular source record, selected indexed publications and available supplier comparisons. Evidence for a named substance does not authenticate a commercial product.

Compiled by PeptideTech Editors · Sources checked · Selected bibliography, not a systematic review

Molecular formula, weight & structure

Molecular formula (MF)
C188H293N53O44S
Molecular weight (MW)
4032 g/mol
PubChem compound ID
16201774
Record title
H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH

Values describe the selected PubChem molecular entity. Counterions, salt forms, hydration and sequence changes can alter the supplied material. Confirm the exact identity against the supplier specification.

Source: PubChem CID 16201774 · retrieved 2026-09-21

2D molecular structure for PNC-27, PubChem CID 16201774
2D depiction from PubChem. Open to inspect the full image. This drawing represents the selected record, not a vendor batch test.
Chemical identifiers and source data
IUPAC name
(4S)-5-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-(carboxymethylamino)-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methylsulfanyl-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-4-[[(2S)-5-amino-2-[[(2S)-3-hydroxy-2-[[(2S)-4-methyl-2-[[(2S)-1-[(2S)-pyrrolidine-2-carbonyl]pyrrolidine-2-carbonyl]amino]pentanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoic acid
InChIKey
MZCACYLMMMXSKC-KOCFKOPYSA-N
SMILES
C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC4=CNC5=CC=CC=C54)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC6=CC=CC=C6)C(=O)N[C@@H](CC7=CNC8=CC=CC=C87)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]9CCCN9C(=O)[C@@H]1CCCN1)O
Machine-readable PubChem source

Identifiers & sequence

PubChem CID
16201774
InChIKey
MZCACYLMMMXSKC-KOCFKOPYSA-N

Peptide sequence · 32 residues (one-letter code; X marks a residue without a one-letter code)

PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Condensed notation with terminal groups and non-standard residues

H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH

Source: PubChem Biologic Line Notation. A reference sequence for the record, not an analysis of a supplied batch.

Calculated molecular descriptors
Monoisotopic (exact) mass4029.2040 Da
Heavy atoms286
Hydrogen-bond donors58
Hydrogen-bond acceptors51
Rotatable bonds136
Topological polar surface area1613.5 Ų
Calculated logP (Crippen)-10.29
Rings10
Stereocenters32
Formal charge0

Computed with RDKit from the published SMILES (Crippen logP, topological polar surface area). Calculated descriptors are not measured properties of a supplied batch.

Registered clinical trials

Studies registered on ClinicalTrials.gov that list PNC-27 as an intervention. Studies that only measure the molecule as a biomarker, or use it only as a comparator or background arm for another drug, are excluded. A registration describes a planned or completed protocol; it does not report a result. Active studies are listed first.

No registered study naming this compound was matched. This is a documented gap in registry coverage, not proof that no study exists.

Registry check 2026-10-01 · Run this search on ClinicalTrials.gov

Human intervention studies

Selected studies in which participants received PNC-27, with their indexed or reviewed study type. Check the original article for the formulation, population and controls. Studies that only measured the molecule, or used it as a comparator, are listed separately below and are not counted as intervention studies.

No human study that administered this compound was retained in this selected bibliography. This is a documented evidence gap in our selection, not proof that no study exists.

    Preclinical research, reviews & other publications

    Animal studies, laboratory experiments, reviews and other indexed papers answer different questions. A review is secondary evidence; a case report does not estimate how often an outcome occurs.

    1. Research publication · design requires review

      PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis.

      Sarafraz-Yazdi E, Mumin S, Cheung D et al. · Biomedicines · 2022

      PMID 35625682 · DOI: 10.3390/biomedicines10050945

    2. Research publication · design requires review

      Targeting Membrane HDM-2 by PNC-27 Induces Necrosis in Leukemia Cells But Not in Normal Hematopoietic Cells.

      Thadi A, Lewis L, Goldstein E et al. · Anticancer research · 2020

      PMID 32878773 · DOI: 10.21873/anticanres.14488

    3. Research publication · design requires review

      Conjugated PNC-27 peptide/PEI-superparamagnetic iron oxide nanoparticles (SPIONs) as a double targeting agent for early cancer diagnosis: In vitro study.

      Rahmani R, Darroudi M, Gharanfoli M et al. · Iranian journal of basic medical sciences · 2022

      PMID 36311203 · DOI: 10.22038/IJBMS.2022.65590.14430

    4. Research publication · design requires review

      Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption.

      Krzesaj P, Adler V, Feinman RD et al. · Annals of clinical and laboratory science · 2024

      PMID 38802154

    5. Research publication · design requires review

      Synergy between Paclitaxel and Anti-Cancer Peptide PNC-27 in the Treatment of Ovarian Cancer.

      Alagkiozidis I, Gorelick C, Shah T et al. · Annals of clinical and laboratory science · 2017

      PMID 28667027

    PNC-27 supplier sources

    Scientific sources describe molecules and experiments. The commercial links below identify recorded supplier packages. A publication or chemical database entry does not verify the seller, purity, sterility or contents of a lot. Some links are affiliate links; see our disclosure.

    PNC-27 for sale: compare prices, sizes and forms from every tracked supplier →

    SupplierRecorded packagesExample source listing
    Amino USAUSD10mg Vial1 recorded offers10mg Vial · $149.99Checked Oct 13, 2026Supplier listing, PNC-27 10mg Vial, Amino USA, opens in a new tab
    Cenexa LabsUSD10mg Vial1 recorded offers10mg Vial · $205.99Checked Oct 13, 2026Supplier listing, PNC-27 10mg Vial, Cenexa Labs, opens in a new tab

    Reference sources & further reading

    The citations above link directly to publication records. Encyclopedia links are background reading and are not used to establish clinical effectiveness.

    Search for additional research

    These links run searches; their results have not been individually reviewed and can include unrelated compounds.

    Research information is not a dosing guide or a recommendation for personal use. Study findings are specific to the formulation, population and methods tested. Read our source and correction policy.

    Related research profiles

    Other compounds

    AICAR

    C9H14N4O5

    258.23 g/mol · PubChem CID 17513

    4 selected publications · 3 human intervention studies · 4 registered trials

    Small molecule · highest stage: Phase 3

    Structure, studies & sources →