Skip to content
PeptideTech
Cart

Home / Research library / FOXO4-DRI

Peptides

FOXO4-DRI: molecular data, studies & sources

FOXO4-DRI is catalogued here as a research compound. This profile brings together the molecular source record, selected indexed publications and available supplier comparisons. Evidence for a named substance does not authenticate a commercial product.

Compiled by PeptideTech Editors · Sources checked · Selected bibliography, not a systematic review

Molecular formula, weight & structure

Molecular formula (MF)
C228H388N86O64
Molecular weight (MW)
5358 g/mol
PubChem compound ID
167312269
Record title
Foxo4-dri

Values describe the selected PubChem molecular entity. Counterions, salt forms, hydration and sequence changes can alter the supplied material. Confirm the exact identity against the supplier specification.

Source: PubChem CID 167312269 · retrieved 2026-09-21

2D molecular structure for FOXO4-DRI, PubChem CID 167312269
2D depiction from PubChem. Open to inspect the full image. This drawing represents the selected record, not a vendor batch test.
Chemical identifiers and source data
IUPAC name
(4R)-5-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[(2R)-5-amino-1-[[(2R)-4-amino-1-[[2-[[(2R)-1-[[(2R)-1-[[(2R)-4-amino-1-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[2-[[2-[[(2R)-6-amino-1-[[(2R)-1-[(2R)-2-[(2R)-2-[(2R)-2-[[(2R)-1-[[(2R)-1-[[(2R)-1-[[(2R)-5-amino-1-[[(2R)-1-[[(2R)-1-[[(2R)-6-amino-1-[[(2R)-6-amino-1-[[(2R)-5-carbamimidamido-1-(carboxymethylamino)-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidine-1-carbonyl]pyrrolidin-1-yl]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-2-oxoethyl]amino]-2-oxoethyl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-1,4-dioxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-[[(2R)-2-[[(2R,3R)-2-[[(2R)-2-[[(2R)-5-amino-2-[[(2R)-2-[[(2R,3R)-2-[[(2R)-2-[[(2R)-2-[[(2R)-2-[[(2R)-1-[(2R)-2-[[(2R)-6-amino-2-[[(2R)-2-[[(2R)-2-[[(2R,3S)-2-[[(2R)-2-amino-4-methylpentanoyl]amino]-3-hydroxybutanoyl]amino]-4-methylpentanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-4-carboxybutanoyl]pyrrolidine-2-carbonyl]amino]propanoyl]amino]-3-hydroxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-methylpentanoyl]amino]propanoyl]amino]-5-oxopentanoyl]amino]-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoic acid
InChIKey
WVZCDZFJLXBWHG-XXZPGMBKSA-N
SMILES
CC[C@@H](C)[C@H](C(=O)N[C@H](C)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CO)C(=O)N[C@H]([C@H](C)CC)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC1=CC=C(C=C1)O)C(=O)N[C@H](CO)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CC(=O)N)C(=O)NCC(=O)N[C@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@H](C)C(=O)N[C@H](CC(=O)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CO)C(=O)NCC(=O)NCC(=O)N[C@H](CCCCN)C(=O)N[C@H](CCCNC(=N)N)C(=O)N4CCC[C@@H]4C(=O)N5CCC[C@@H]5C(=O)N6CCC[C@@H]6C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCCNC(=N)N)C(=O)NCC(=O)O)NC(=O)[C@@H](CCC(=O)O)NC(=O)[C@@H](CO)NC(=O)[C@@H](C)NC(=O)[C@H]7CCCN7C(=O)[C@@H](CCC(=O)O)NC(=O)[C@@H](CCCCN)NC(=O)[C@@H](CCCNC(=N)N)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H]([C@H](C)O)NC(=O)[C@@H](CC(C)C)N
Machine-readable PubChem source

Identifiers & sequence

PubChem CID
167312269
InChIKey
WVZCDZFJLXBWHG-XXZPGMBKSA-N

Peptide sequence · 46 residues (one-letter code; X marks a residue without a one-letter code)

LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG

Condensed notation with terminal groups and non-standard residues

H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-Gly-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-Gly-OH

Source: PubChem Biologic Line Notation. A reference sequence for the record, not an analysis of a supplied batch.

Calculated molecular descriptors
Monoisotopic (exact) mass5354.9750 Da
Heavy atoms378
Hydrogen-bond donors92
Hydrogen-bond acceptors75
Rotatable bonds184
Topological polar surface area2525.3 Ų
Calculated logP (Crippen)-31.61
Rings7
Stereocenters45
Formal charge0

Computed with RDKit from the published SMILES (Crippen logP, topological polar surface area). Calculated descriptors are not measured properties of a supplied batch.

Registered clinical trials

Studies registered on ClinicalTrials.gov that list FOXO4-DRI as an intervention. Studies that only measure the molecule as a biomarker, or use it only as a comparator or background arm for another drug, are excluded. A registration describes a planned or completed protocol; it does not report a result. Active studies are listed first.

No registered study naming this compound was matched. This is a documented gap in registry coverage, not proof that no study exists.

Registry check 2026-10-01 · Run this search on ClinicalTrials.gov

Human intervention studies

Selected studies in which participants received FOXO4-DRI, with their indexed or reviewed study type. Check the original article for the formulation, population and controls. Studies that only measured the molecule, or used it as a comparator, are listed separately below and are not counted as intervention studies.

No human study that administered this compound was retained in this selected bibliography. This is a documented evidence gap in our selection, not proof that no study exists.

    Preclinical research, reviews & other publications

    Animal studies, laboratory experiments, reviews and other indexed papers answer different questions. A review is secondary evidence; a case report does not estimate how often an outcome occurs.

    1. Research publication · design requires review

      The disordered p53 transactivation domain is the target of FOXO4 and the senolytic compound FOXO4-DRI.

      Bourgeois B, Spreitzer E, Platero-Rochart D et al. · Nature communications · 2025

      PMID 40593617 · DOI: 10.1038/s41467-025-60844-9

    2. Research publication · design requires review

      FOXO4-DRI regulates endothelial cell senescence via the P53 signaling pathway.

      Hu Z, Li F, Hu C et al. · Frontiers in bioengineering and biotechnology · 2025

      PMID 41625068 · DOI: 10.3389/fbioe.2025.1729166

    3. Research publication · design requires review

      FOXO4-DRI induces keloid senescent fibroblast apoptosis by promoting nuclear exclusion of upregulated p53-serine 15 phosphorylation.

      Kong YX, Li ZS, Liu YB et al. · Communications biology · 2025

      PMID 39994346 · DOI: 10.1038/s42003-025-07738-0

    4. Preclinical / laboratory research

      FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice.

      Zhang C, Xie Y, Chen H et al. · Aging · 2020

      PMID 31959736 · DOI: 10.18632/aging.102682

    FOXO4-DRI supplier sources

    Scientific sources describe molecules and experiments. The commercial links below identify recorded supplier packages. A publication or chemical database entry does not verify the seller, purity, sterility or contents of a lot. Some links are affiliate links; see our disclosure.

    FOXO4-DRI for sale: compare prices, sizes and forms from every tracked supplier →

    SupplierRecorded packagesExample source listing
    Amino USAUSD10mg Vial1 recorded offers10mg Vial · $229.99Checked Oct 12, 2026Supplier listing, FOXO4-DRI 10mg Vial, Amino USA, opens in a new tab
    Cenexa LabsUSD10mg Vial1 recorded offers10mg Vial · $167.99Checked Oct 12, 2026Supplier listing, FOXO4-DRI 10mg Vial, Cenexa Labs, opens in a new tab

    Reference sources & further reading

    The citations above link directly to publication records. Encyclopedia links are background reading and are not used to establish clinical effectiveness.

    Search for additional research

    These links run searches; their results have not been individually reviewed and can include unrelated compounds.

    Research information is not a dosing guide or a recommendation for personal use. Study findings are specific to the formulation, population and methods tested. Read our source and correction policy.

    Related research profiles

    Peptides

    Glutathione

    C10H17N3O6S

    307.33 g/mol · PubChem CID 124886

    7 selected publications · 3 human intervention studies · 37 registered trials

    Small molecule · highest stage: Phase 3

    Structure, studies & sources →

    Other compounds

    L-Carnitine

    C7H15NO3

    161.20 g/mol · PubChem CID 10917

    8 selected publications · 0 human intervention studies · 40 registered trials

    Small molecule · highest stage: Approved in at least one jurisdiction (ChEMBL phase 4)

    Structure, studies & sources →