MK-677 vs Tesamorelin: prices, identity and regulatory status (2026)
MK-677 and Tesamorelin are different research compounds, not substitutes for each other: MK-677 is a single compound (C27H36N4O5S); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Lowest current in-stock prices: MK-677 15mg×60 from $129.99 at Cenexa Labs; Tesamorelin 10mg from $69.99 ($7.00/mg) at Amino Club. MK-677 has no Drugs@FDA application; Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
MK-677 vs Tesamorelin: current prices and packages
| Compared property | MK-677 | Tesamorelin |
|---|---|---|
| Category | SARMs | Growth hormone |
| Compared package | 15mg×60 · Capsules | 10mg · Vial |
| Lowest current price | $129.99 at Cenexa Labs, checked Oct 16, 2026 | $69.99 at Amino Club, checked Oct 14, 2026 |
| Price per labelled mg | Exact package total only | $7.00/mg |
| Package sizes | 25mg-per-mL-30mL, 10mg×60, 12.5mg×60, 15mg×60, 25mg×60, 2000mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 1 | 5 (6 tracked) |
| Form at this package | Capsules | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | MK-677 | Tesamorelin |
|---|---|---|
| Molecular formula | C27H36N4O5S | C221H366N72O67S |
| Molecular weight | 528.7 g/mol | 5136 g/mol |
| Sequence | — | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 159634-47-6 | 218949-48-5 |
| Registered clinical trials | 4 · Phase 2: 3, Not applicable: 1 | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | 4 | 7 |
| US regulatory status | No Drugs@FDA application (checked October 7, 2026) · Drugs@FDA search | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
MK-677
- MK-0677 (ibutamoren mesylate) for the treatment of patients recovering from hip fracture: a multicenter, randomized, placebo-controlled phase IIb study. Archives of gerontology and geriatrics, 2011
- Effects of an oral ghrelin mimetic on body composition and clinical outcomes in healthy older adults: a randomized trial. Annals of internal medicine, 2008
- Growth hormone secretagogue MK-677: no clinical effect on AD progression in a randomized trial. Neurology, 2008
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
MK-677
MK-677 is a catalogue entry whose compound-specific reference review has not yet been completed.
$129.99 · 15mg×60 · Cenexa Labs
View at Cenexa Labs, MK-677 15mg×60, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankMK-677 prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$69.99 · 10mg · $7.00/mg · Amino Club
View at Amino Club, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →