AOD-9604 vs Tesamorelin: price per mg, identity and regulatory status (2026)
AOD-9604 and Tesamorelin are different research compounds, not substitutes for each other: AOD-9604 is a 16-amino-acid peptide (C78H123N23O23S2); Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S). Lowest current in-stock prices: AOD-9604 5mg from $49.99 ($10.00/mg) at Amino Club; Tesamorelin 10mg from $69.99 ($7.00/mg) at Amino Club. Tesamorelin shares its active ingredient with an FDA-approved prescription medicine.
AOD-9604 vs Tesamorelin: current prices and packages
| Compared property | AOD-9604 | Tesamorelin |
|---|---|---|
| Category | Healing | Growth hormone |
| Compared package | 5mg · Vial | 10mg · Vial |
| Lowest current price | $49.99 at Amino Club, checked Oct 14, 2026 | $69.99 at Amino Club, checked Oct 14, 2026 |
| Price per labelled mg | $10.00/mg | $7.00/mg |
| Package sizes | 2mg, 5mg, 10mg | 2mg, 5mg, 10mg, 20mg, 50mg |
| Vendors with current prices | 4 (5 tracked) | 5 (6 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | AOD-9604 | Tesamorelin |
|---|---|---|
| Molecular formula | C78H123N23O23S2 | C221H366N72O67S |
| Molecular weight | 1815.1 g/mol | 5136 g/mol |
| Sequence | H-Tyr-Leu-Arg-Ile-Val-Gln-Cys(1)-Arg-Ser-Val-Glu-Gly-Ser-Cys(1)-Gly-Phe-OH (16 residues) | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) |
| CAS Registry Number | 221231-10-3 | 218949-48-5 |
| Registered clinical trials | None recorded | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 |
| Human intervention studies | None recorded | 7 |
| US regulatory status | No reviewed Drugs@FDA record | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
AOD-9604
No human intervention study is recorded in the research library for this identity.
AOD-9604 research profile →Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Where to buy each compound
AOD-9604
FDA describes AOD-9604 as a 16-amino-acid peptide comprising hGH residues 177–191 plus an N-terminal tyrosine. This modification is part of its identity, not an optional naming detail.
$49.99 · 5mg · $10.00/mg · Amino Club
View at Amino Club, AOD-9604 5mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankAOD-9604 prices →Price history →Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$69.99 · 10mg · $7.00/mg · Amino Club
View at Amino Club, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →