Tesamorelin vs Tirzepatide: research-use price per mg, identity and FDA status (2026)
Tesamorelin and Tirzepatide are different research compounds, not substitutes for each other: Tesamorelin is a 44-amino-acid peptide (C221H366N72O67S); Tirzepatide is a single compound (C225H348N48O68). Lowest current research-use listings: Tesamorelin 10mg from $69.99 ($7.00/mg) at Amino Club; Tirzepatide 30mg from $59.99 ($2.00/mg) at Amino Club. Tesamorelin shares its active ingredient with an FDA-approved prescription medicine; Tirzepatide shares its active ingredient with an FDA-approved prescription medicine.
Research use only. These are research-use-only listings sold for laboratory research, not prescription medicines and not for human use. PeptideTech does not compare effects or provide dosing information.
Tesamorelin vs Tirzepatide: current prices and packages
| Compared property | Tesamorelin | Tirzepatide |
|---|---|---|
| Category | Growth hormone | GLP-1 |
| Compared package | 10mg · Vial | 30mg · Vial |
| Lowest current price | $69.99 at Amino Club, checked Oct 14, 2026 | $59.99 at Amino Club, checked Oct 14, 2026 |
| Price per labelled mg | $7.00/mg | $2.00/mg |
| Package sizes | 2mg, 5mg, 10mg, 20mg, 50mg | 10mg, 15mg, 20mg, 30mg, 40mg, 60mg, 100mg |
| Vendors with current prices | 5 (6 tracked) | 3 (4 tracked) |
| Form at this package | Vial | Vial |
| Stock | In stock | In stock |
Prices exclude shipping. The price per labelled mg is always given per mg, so different package sizes compare directly; it is shown only for single-compound vials and powders with a labelled mass. Blends, capsules, liquids and IU-labelled packages are compared by package total.
Identity, regulatory status and registered research
| Compared property | Tesamorelin | Tirzepatide |
|---|---|---|
| Molecular formula | C221H366N72O67S | C225H348N48O68 |
| Molecular weight | 5136 g/mol | 4813 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) | — |
| CAS Registry Number | 218949-48-5 | — |
| Registered clinical trials | 20 (3 active) · Phase 4: 2, Phase 3: 2, Phase 2: 9 | 38 (38 active) · Phase 4: 9, Phase 3: 6, Phase 2: 14 |
| Human intervention studies | 7 | 7 |
| US regulatory status | FDA-approved prescription medicine with this active ingredient: Egrifta (BLA 022505; checked October 7, 2026)MarketedEGRIFTA · BLA 022505 · 2010Research listings are not these medicines. | FDA-approved prescription medicine with this active ingredient: Mounjaro and Zepbound (NDA 215866 and NDA 217806; checked October 7, 2026)MarketedMOUNJARO · NDA 215866 · 2022ZEPBOUND · NDA 217806 · 2023Research listings are not these medicines. |
Identity data: PubChem, FDA GSRS and EPA records; registry counts: ClinicalTrials.gov; status: Drugs@FDA. A matching name does not verify the contents of a supplier's lot.
Key human studies
Tesamorelin
- Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. The Journal of infectious diseases, 2025
- Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS (London, England), 2024
- Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The lancet. HIV, 2019
Tirzepatide
- Tirzepatide for Obesity Treatment and Diabetes Prevention. The New England journal of medicine, 2025
- Tirzepatide for Heart Failure with Preserved Ejection Fraction and Obesity. The New England journal of medicine, 2025
- Tirzepatide for the Treatment of Obstructive Sleep Apnea and Obesity. The New England journal of medicine, 2024
Studies are listed as records, newest first; they are not evidence that a research product is safe or effective.
Research-use listings for each compound
Research-use-only listings sold for laboratory research, not prescription medicines and not for human use.
Tesamorelin
Tesamorelin is a catalogue entry whose compound-specific reference review has not yet been completed.
$69.99 · 10mg · $7.00/mg · Amino Club
View at Amino Club, Tesamorelin 10mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTesamorelin prices →Price history →Tirzepatide
Tirzepatide acts at GIP and GLP-1 receptors and is the active substance in the EU-authorized prescription medicine Mounjaro. Its medicinal-product assessment is separate from a supplier’s research catalogue listing.
$59.99 · 30mg · $2.00/mg · Amino Club
View at Amino Club, Tirzepatide 30mg, opens in a new tabPeptideTech does not sell or fulfill products. Some outgoing links can earn a commission, which does not determine price order. How we rankTirzepatide prices →Price history →Related comparisons
Questions
Automated price sources are scheduled daily; other sources are checked manually. Check the offer's last successful source timestamp. A code is shown when it is attached to an offer or affiliate link. The displayed price includes a discount only when that code is cart-verified and the discounted price is explicitly recorded; otherwise it is the vendor's listed price. Prices exclude shipping. Stock status is captured at the same time. Rankings are by displayed price only. PeptideTech earns a commission when you buy through a link; it never changes the order.
Full method →